Rabbit anti-Human Renin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15499P

• Product Name:
• Rabbit anti-Human Renin Monoclonal Antibody

• Synonym:
• RTD; HNFJ2; ADTKD4; Renin

• Description:
• The antibody against Renin was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 250-406AA of human Renin (NP_000528.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant Protein corresponding to a sequence within amino acids 250-406AA of human Renin (NP_000528.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Renin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

• Gene ID:
• 5972

• Uniprot-ID:
• P00797

• Purification Method:
• Mouse kidney, Mouse lung, Mouse ovary, Rat kidney, Rat lung

• Positive Samples:
• Affinity purification