Rabbit anti-Human RanBP9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16273P

• Product Name:
• Rabbit anti-Human RanBP9 Monoclonal Antibody

• Synonym:
• BPM-L; BPM90; RANBPM; RanBP7; RanBP9

• Description:
• The antibody against RanBP9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RanBP9 (Q96S59) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RanBP9 (Q96S59).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RanBP9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSALNEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAA

• Gene ID:
• 10048

• Uniprot-ID:
• Q96S59

• Purification Method:
• C2C12, RD, C6, Mouse testis, Rat testis

• Positive Samples:
• Affinity purification