Rabbit anti-Human Rad51 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16028P

• Product Name:
• Rabbit anti-Human Rad51 Monoclonal Antibody

• Synonym:
• RECA; BRCC5; FANCR; MRMV2; HRAD51; RAD51A; HsRad51; HsT16930; Rad51

• Description:
• The antibody against Rad51 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Rad51

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII

• Gene ID:
• 5888

• Uniprot-ID:
• Q06609

• Purification Method:
• HeLa, MCF7, Mouse testis, Rat testis

• Positive Samples:
• Affinity purification