Rabbit anti-Human RAB9P40 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14338P

• Product Name:
• Rabbit anti-Human RAB9P40 Monoclonal Antibody

• Synonym:
• p40; RAB9P40; bA65N13.1

• Description:
• The antibody against RAB9P40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• RAB9P40

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD

• Gene ID:
• 10244

• Uniprot-ID:
• Q7Z6M1

• Purification Method:
• A549, Mouse testis, Mouse brain, Rat testis

• Positive Samples:
• Affinity purification