Rabbit anti-Human Pyrophosphatase 1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13472P

• Product Name:
• Rabbit anti-Human Pyrophosphatase 1 Monoclonal Antibody

• Synonym:
• PP; PP1; IOPPP; HEL-S-66p; SID6-8061; Pyrophosphatase 1

• Description:
• The antibody against Pyrophosphatase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyrophosphatase 1 (Q15181).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Pyrophosphatase 1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT

• Gene ID:
• 5464

• Uniprot-ID:
• Q15181

• Purification Method:
• MCF7, OVCAR3, Mouse large intestine, Mouse liver, Rat liver

• Positive Samples:
• Affinity purification