Rabbit anti-Human Pumilio 1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14106P

• Product Name:
• Rabbit anti-Human Pumilio 1 Monoclonal Antibody

• Synonym:
• PUMH; HSPUM; PUMH1; PUML1; SCA47; Pumilio 1

• Description:
• The antibody against Pumilio 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human Pumilio 1 (Q14671) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 104-203 of human Pumilio 1 (Q14671).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Pumilio 1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSE

• Gene ID:
• 9698

• Uniprot-ID:
• Q14671

• Purification Method:
• Jurkat, Mouse testis

• Positive Samples:
• Affinity purification