Rabbit anti-Human PTPIP51/RMDN3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14741P

• Product Name:
• Rabbit anti-Human PTPIP51/RMDN3 Monoclonal Antibody

• Synonym:
• RMD3; RMD-3; FAM82C; FAM82A2; ptpip51; PTPIP51/RMDN3

• Description:
• The antibody against PTPIP51/RMDN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTPIP51/RMDN3 (NP_060615.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PTPIP51/RMDN3 (NP_060615.1).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PTPIP51/RMDN3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY

• Gene ID:
• 55177

• Uniprot-ID:
• Q96TC7

• Purification Method:
• Rat lung

• Positive Samples:
• Affinity purification