Rabbit anti-Human PSMB10 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14552P

• Product Name:
• Rabbit anti-Human PSMB10 Monoclonal Antibody

• Synonym:
• LMP10; MECL1; PRAAS5; beta2i; PSMB10

• Description:
• The antibody against PSMB10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (P40306) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-273 of human PSMB10 (P40306).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PSMB10

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

• Gene ID:
• 5699

• Uniprot-ID:
• P40306

• Purification Method:
• Raji, 293T, Mouse liver, Rat lung, Rat spleen, Rat thymus

• Positive Samples:
• Affinity purification