Rabbit anti-Human PRP19 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14206P

• Product Name:
• Rabbit anti-Human PRP19 Monoclonal Antibody

• Synonym:
• PSO4; SNEV; PRP19; UBOX4; hPSO4; NMP200

• Description:
• The antibody against PRP19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 400-504 of human PRPF19(Q9UMS4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 400-504 of human PRPF19(Q9UMS4).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PRP19

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYSL

• Gene ID:
• 27339

• Uniprot-ID:
• Q9UMS4

• Purification Method:
• HeLa, SKOV3, Mouse thymus, Rat spleen

• Positive Samples:
• Affinity purification