Rabbit anti-Human PRMT4/CARM1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17170P

• Product Name:
• Rabbit anti-Human PRMT4/CARM1 Monoclonal Antibody

• Synonym:
• PRMT4; M1

• Description:
• The antibody against PRMT4/CARM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PRMT4/CARM1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT

• Gene ID:
• 10498

• Uniprot-ID:
• Q86X55

• Purification Method:
• MCF7, 293T, Mouse testis, Rat testis

• Positive Samples:
• Affinity purification