Rabbit anti-Human PRK2/PKN2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14255P

• Product Name:
• Rabbit anti-Human PRK2/PKN2 Monoclonal Antibody

• Synonym:
• PAK2; PRK2; STK7; Pak-2; PRKCL2; PRO2042; PRK2/PKN2

• Description:
• The antibody against PRK2/PKN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRK2/PKN2 (Q16513) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRK2/PKN2 (Q16513).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PRK2/PKN2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKELKIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKL

• Gene ID:
• 5586

• Uniprot-ID:
• Q16513

• Purification Method:
• HeLa, NIH/3T3, Jurkat, C6

• Positive Samples:
• Affinity purification