Rabbit anti-Human PP1 beta Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13856P

• Product Name:
• Rabbit anti-Human PP1 beta Monoclonal Antibody

• Synonym:
• MP; PP1B; PP1c; NSLH2; PP-1B; PPP1CD; PP1beta; PPP1beta; HEL-S-80p; PP1 beta

• Description:
• The antibody against PP1 beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 228-327 of human PP1 beta (P62140) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 228-327 of human PP1 beta (P62140).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PP1 beta

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

• Gene ID:
• 5500

• Uniprot-ID:
• P62140

• Purification Method:
• PC-3, U-251MG, Mouse brain, Rat testis, Rat brain, Rat heart

• Positive Samples:
• Affinity purification