Rabbit anti-Human PODXL Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13193P

• Product Name:
• Rabbit anti-Human PODXL Monoclonal Antibody

• Synonym:
• PC; PDX; PCLP; Gp200; gp135; PCLP-1; PODXL1; PODXL

• Description:
• The antibody against PODXL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-479 of human PODXL (O00592) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 300-479 of human PODXL (O00592).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PODXL

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAAL

• Gene ID:
• 5420

• Uniprot-ID:
• O00592

• Purification Method:
• HCT 116, 293T, U-251MG

• Positive Samples:
• Affinity purification