Rabbit anti-Human Podoplanin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16140P

• Product Name:
• Rabbit anti-Human Podoplanin Monoclonal Antibody

• Synonym:
• T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; D2-40; T1A-2; AGGRUS; HT1A-1; PA2.26; Podoplanin

• Description:
• The antibody against Podoplanin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 63-162 of human Podoplanin (Q86YL7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 63-162 of human Podoplanin (Q86YL7).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Podoplanin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

• Gene ID:
• 10630

• Uniprot-ID:
• Q86YL7

• Purification Method:
• U2OS, U-87MG, Mouse lung

• Positive Samples:
• Affinity purification