Rabbit anti-Human PLOD3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13273P

• Product Name:
• Rabbit anti-Human PLOD3 Monoclonal Antibody

• Synonym:
• LH3; PLOD3

• Description:
• The antibody against PLOD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-306 of human PLOD3 (NP_001075.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 25-306 of human PLOD3 (NP_001075.1).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PLOD3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFLAVFVEQ

• Gene ID:
• 8985

• Uniprot-ID:
• O60568

• Purification Method:
• HepG2, MCF7, BxPC-3, Jurkat, Mouse brain

• Positive Samples:
• Affinity purification