Rabbit anti-Human PKM2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16871P

• Product Name:
• Rabbit anti-Human PKM2 Monoclonal Antibody

• Synonym:
• PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; HEL-S-30

• Description:
• The antibody against PKM2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PKM2 (P14618) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PKM2 (P14618).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PKM2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFAS

• Gene ID:
• 5315

• Uniprot-ID:
• P14618

• Purification Method:
• HeLa, 293T, A-549, NIH/3T3, C6, Mouse skeletal muscle, Mouse heart, Rat skeletal muscle

• Positive Samples:
• Affinity purification