Rabbit anti-Human PKM1-specific Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14514P

• Product Name:
• Rabbit anti-Human PKM1-specific Monoclonal Antibody

• Synonym:
• PK3; TCB; p58; OIP3; PKM2; CTHBP; THBP1; HEL-S-30; PKM1-specific

• Description:
• The antibody against PKM1-specific was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PKM1 (NP_001193728.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PKM1 (NP_001193728.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PKM1-specific

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHSTDLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYR

• Gene ID:
• 5315

• Uniprot-ID:
• P14618

• Purification Method:
• RD, Mouse skeletal muscle, Rat skeletal muscle, Rat brain

• Positive Samples:
• Affinity purification