Rabbit anti-Human PKC gamma Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14080P

• Product Name:
• Rabbit anti-Human PKC gamma Monoclonal Antibody

• Synonym:
• PKCC; PKCG; SCA14; PKCI(3); PKCgamma; PKC-gamma; PKC gamma

• Description:
• The antibody against PKC gamma was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 604-697 of human PKC gamma (P05129) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 604-697 of human PKC gamma (P05129).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PKC gamma

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM

• Gene ID:
• 5582

• Uniprot-ID:
• P05129

• Purification Method:
• Mouse brain, Rat brain

• Positive Samples:
• Affinity purification