Rabbit anti-Human PJVK Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15372P

• Product Name:
• Rabbit anti-Human PJVK Monoclonal Antibody

• Synonym:
• DFNB59; PJVK

• Description:
• The antibody against PJVK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-352 of human PJVK（NP_001036167.1） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 290-352 of human PJVK（NP_001036167.1）.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PJVK

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KEGTHIRVNLLNHNIPKGPCILCGMGNFKRETVYGCFQCSVDGQKYVRLHAVPCFDIWHKRMK

• Gene ID:
• 494513

• Uniprot-ID:
• Q0ZLH3

• Purification Method:
• 293T-PJVK

• Positive Samples:
• Affinity purification