Rabbit anti-Human PIK3C3/VPS34 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16572P

• Product Name:
• Rabbit anti-Human PIK3C3/VPS34 Monoclonal Antibody

• Synonym:
• VPS34; Vps34; hVps34; PIK3C3/VPS34

• Description:
• The antibody against PIK3C3/VPS34 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 788-887 of human PIK3C3/VPS34 (Q8NEB9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 788-887 of human PIK3C3/VPS34 (Q8NEB9).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PIK3C3/VPS34

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

• Gene ID:
• 5289

• Uniprot-ID:
• Q8NEB9

• Purification Method:
• RD, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification