Rabbit anti-Human PHD3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16287P

• Product Name:
• Rabbit anti-Human PHD3 Monoclonal Antibody

• Synonym:
• PHD3; HIFPH3; HIFP4H3

• Description:
• The antibody against PHD3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-239 of human PHD3 (Q9H6Z9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-239 of human PHD3 (Q9H6Z9).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PHD3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED

• Gene ID:
• 112399

• Uniprot-ID:
• Q9H6Z9

• Purification Method:
• PC-12, A-549, Mouse brain, Rat stomach

• Positive Samples:
• Affinity purification