Rabbit anti-Human PGC1 beta Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14300P

• Product Name:
• Rabbit anti-Human PGC1 beta Monoclonal Antibody

• Synonym:
• PERC; ERRL1; PGC1B; PGC-1(beta); PGC1 beta

• Description:
• The antibody against PGC1 beta was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 924-1023 of human PGC1 beta (NP_573570.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 924-1023 of human PGC1 beta (NP_573570.3).

• Species Reactivity:
• Human, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PGC1 beta

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH

• Gene ID:
• 133522

• Uniprot-ID:
• Q86YN6

• Purification Method:
• HeLa, SH-SY5Y, Rat testis

• Positive Samples:
• Affinity purification