Rabbit anti-Human PGC1α Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17034P

• Product Name:
• Rabbit anti-Human PGC1α Monoclonal Antibody

• Synonym:
• LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1alpha; PGC-1(alpha); PGC1α

• Description:
• The antibody against PGC1α was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 340-480 of human PGC1α (NP_037393.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 340-480 of human PGC1α (NP_037393.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PGC1α

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QGNNSTKKGPEQSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQGQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK

• Gene ID:
• 10891

• Uniprot-ID:
• Q9UBK2

• Purification Method:
• HeLa, Mouse kidney, Rat kidney, Rat stomach

• Positive Samples:
• Affinity purification