Rabbit anti-Human PGC1α/β Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17045P

• Product Name:
• Rabbit anti-Human PGC1α/β Monoclonal Antibody

• Synonym:
• LEM6; PGC-1(alpha); PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; ERRL1; PERC; PGC-1(beta); PGC1B; PGC1α/β

• Description:
• The antibody against PGC1α/β was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 699-798 of human PGC1α/β (NP_037393.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 699-798 of human PGC1α/β (NP_037393.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PGC1α/β

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

• Gene ID:
• 10891133522

• Uniprot-ID:
• Q9UBK2

• Purification Method:
• Mouse liver, Rat heart

• Positive Samples:
• Affinity purification