Rabbit anti-Human PE Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-08278P

• Product Name:
• Rabbit anti-Human PE Monoclonal Antibody

• Synonym:
• MS4A1; B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7; B-lymphocyte antigen CD20

• Description:
• The antibody against PE was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.03% proclin300, 0.2% BSA, pH7.3.

• Storage:
• Store at 2-8℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PE

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF

• Gene ID:
• 931

• Uniprot-ID:
• P11836

• Positive Samples:
• Affinity purification