Rabbit anti-Human PCNA Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17144P

• Product Name:
• Rabbit anti-Human PCNA Monoclonal Antibody

• Synonym:
• ATLD2; PCNA

• Description:
• The antibody against PCNA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1).

• Species Reactivity:
• Human, Mouse, Rat, African green monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PCNA

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

• Gene ID:
• 5111

• Uniprot-ID:
• P12004

• Purification Method:
• HeLa cells, MCF7 cells, 293T cells, C2C12 cells, COS-7 cells, Mouse spleen, Rat testis

• Positive Samples:
• Affinity purification