Rabbit anti-Human PAX3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14840P

• Product Name:
• Rabbit anti-Human PAX3 Monoclonal Antibody

• Synonym:
• WS1; WS3; CDHS; HUP2; PAX-3; PAX3

• Description:
• The antibody against PAX3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX3 (NP_852122.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 350-450 of human PAX3 (NP_852122.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• PAX3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP

• Gene ID:
• 5077

• Uniprot-ID:
• P23760

• Purification Method:
• 293T, U-251MG, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification