Rabbit anti-Human Pan Cadherin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16608P

• Product Name:
• Rabbit anti-Human Pan Cadherin Monoclonal Antibody

• Synonym:
• Arc-1; CD324; CDHE; ECAD; LCAM; UVO; Pan Cadherin

• Description:
• The antibody against Pan Cadherin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 806-906 of human Cadherin-2 (CDH2) (P19022) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 806-906 of human Cadherin-2 (CDH2) (P19022).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Pan Cadherin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• IRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD

• Gene ID:
• 999100010011001100212561

• Uniprot-ID:
• P12830

• Purification Method:
• HeLa, Mouse liver

• Positive Samples:
• Affinity purification