Rabbit anti-Human p63 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13609P

• Product Name:
• Rabbit anti-Human p63 Monoclonal Antibody

• Synonym:
• AIS; KET; LMS; NBP; RHS; p40; p51; p63; EEC3; OFC8; p73H; p73L; SHFM4; TP53L; TP73L; p53CP; TP53CP; B(p51A); B(p51B)

• Description:
• The antibody against p63 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-203 of human p63 (Q9H3D4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-203 of human p63 (Q9H3D4).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• p63

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKKLYC

• Gene ID:
• 8626

• Uniprot-ID:
• Q9H3D4

• Purification Method:
• 293T cells, DU145 cells, MCF7 cells, Mouse thymus, Mouse skeletal muscle

• Positive Samples:
• Affinity purification