Rabbit anti-Human P4HA2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16342P

• Product Name:
• Rabbit anti-Human P4HA2 Monoclonal Antibody

• Synonym:
• MYP25; lncRNA-PE; P4HA2

• Description:
• The antibody against P4HA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 157-333 of human P4HA2 (NP_004190.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 157-333 of human P4HA2 (NP_004190.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• P4HA2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GTKYQAMLSVDDCFGMGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATTTKSQVLDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEW

• Gene ID:
• 8974

• Uniprot-ID:
• O15460

• Purification Method:
• MCF7, HepG2, Mouse placenta, Rat testis

• Positive Samples:
• Affinity purification