Rabbit anti-Human p47phox/NCF1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13944P

• Product Name:
• Rabbit anti-Human p47phox/NCF1 Monoclonal Antibody

• Synonym:
• CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A; p47phox/NCF1

• Description:
• The antibody against p47phox/NCF1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 291-390 of human p47phox/NCF1 (P14598).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• p47phox/NCF1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV

• Gene ID:
• 653361

• Uniprot-ID:
• P14598

• Purification Method:
• Raji

• Positive Samples:
• Affinity purification