Rabbit anti-Human P2RX4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15723P

• Product Name:
• Rabbit anti-Human P2RX4 Monoclonal Antibody

• Synonym:
• P2X4; P2X4R; P2RX4

• Description:
• The antibody against P2RX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-338 of human P2RX4（NP_002551.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 55-338 of human P2RX4（NP_002551.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• P2RX4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMIN

• Gene ID:
• 5025

• Uniprot-ID:
• Q99571

• Purification Method:
• MCF7, T-47D

• Positive Samples:
• Affinity purification