Rabbit anti-Human Osteopontin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13639P

• Product Name:
• Rabbit anti-Human Osteopontin Monoclonal Antibody

• Synonym:
• OPN; BNSP; BSPI; ETA-1; Osteopontin

• Description:
• The antibody against Osteopontin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Osteopontin (P10451).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Osteopontin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKF

• Gene ID:
• 6696

• Uniprot-ID:
• P10451

• Purification Method:
• 293T, HepG2, Jurkat, U-251MG

• Positive Samples:
• Affinity purification