Rabbit anti-Human ORP1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13219P

• Product Name:
• Rabbit anti-Human ORP1 Monoclonal Antibody

• Synonym:
• ORP1; ORP-1; OSBPL1B

• Description:
• The antibody against ORP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 851-950 of human ORP1 (Q9BXW6).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• ORP1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQRAARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY

• Gene ID:
• 114876

• Uniprot-ID:
• Q9BXW6

• Purification Method:
• HeLa, 293T, SH-SY5Y, Mouse brain, Mouse spleen, Mouse heart, Rat liver, Rat brain

• Positive Samples:
• Affinity purification