Rabbit anti-Human NUR77 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16432P

• Product Name:
• Rabbit anti-Human NUR77 Monoclonal Antibody

• Synonym:
• HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77; [KD Validated] NUR77

• Description:
• The antibody against NUR77 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human NUR77 (NP_002126.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human NUR77 (NP_002126.2)

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NUR77

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK

• Gene ID:
• 3164

• Uniprot-ID:
• P22736

• Purification Method:
• HeLa, PC-3

• Positive Samples:
• Affinity purification