Rabbit anti-Human NRF2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17244P

• Product Name:
• Rabbit anti-Human NRF2 Monoclonal Antibody

• Synonym:
• NRF2; HEBP1; Nrf-2; IMDDHH; F2

• Description:
• The antibody against NRF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 505-605 of human NRF2 (NP_006155.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 505-605 of human NRF2 (NP_006155.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP, ChIP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NRF2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• GKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDVKKN

• Gene ID:
• 4780

• Uniprot-ID:
• Q16236

• Purification Method:
• 293T, HeLa

• Positive Samples:
• Affinity purification