Rabbit anti-Human Notch1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17007P

• Product Name:
• Rabbit anti-Human Notch1 Monoclonal Antibody

• Synonym:
• hN1; AOS5; TAN1; AOVD1; Notch1

• Description:
• The antibody against Notch1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (P46531) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human Notch1 (P46531).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Notch1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK

• Gene ID:
• 4851

• Uniprot-ID:
• P46531

• Purification Method:
• 293T, Jurkat, Mouse lung, Mouse brain

• Positive Samples:
• Affinity purification