Rabbit anti-Human Nogo Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14580P

• Product Name:
• Rabbit anti-Human Nogo Monoclonal Antibody

• Synonym:
• ASY; NSP; NOGO; RTN-X; NSP-CL; RTN4-A; RTN4-C; RTN4-B1; RTN4-B2; NI220/250; Nbla00271; Nbla10545; Nogo

• Description:
• The antibody against Nogo was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 60-160 of human Nogo (NP_065393.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 60-160 of human Nogo (NP_065393.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Nogo

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWT

• Gene ID:
• 57142

• Uniprot-ID:
• Q9NQC3

• Purification Method:
• SH-SY5Y

• Positive Samples:
• Affinity purification