Rabbit anti-Human NNMT Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15738P

• Product Name:
• Rabbit anti-Human NNMT Monoclonal Antibody

• Synonym:
• Nicotinamide N-methyltransferase

• Description:
• The antibody against NNMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human NNMT (NP_006160.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NNMT

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

• Gene ID:
• 4837

• Uniprot-ID:
• P40261

• Purification Method:
• A549, HeLa

• Positive Samples:
• Affinity purification