Rabbit anti-Human NF-κB2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16535P

• Product Name:
• Rabbit anti-Human NF-κB2 Monoclonal Antibody

• Synonym:
• p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100; NF-κB2

• Description:
• The antibody against NF-κB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 745-877 of human NF-κB2 (Q00653) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 745-877 of human NF-κB2 (Q00653).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NF-κB2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEA

• Gene ID:
• 4791

• Uniprot-ID:
• Q00653

• Purification Method:
• THP-1, MCF7, HeLa, NIH/3T3, C6, Mouse thymus

• Positive Samples:
• Affinity purification