Rabbit anti-Human Neurokinin 1 Receptor (NK1R) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16073P

• Product Name:
• Rabbit anti-Human Neurokinin 1 Receptor (NK1R) Monoclonal Antibody

• Synonym:
• SPR; NK1R; NKIR; TAC1R; Neurokinin 1 Receptor (NK1R)

• Description:
• The antibody against Neurokinin 1 Receptor (NK1R) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-407 of human Neurokinin 1 Receptor (NK1R) (NK1R) (P25103) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-407 of human Neurokinin 1 Receptor (NK1R) (NK1R) (P25103).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Neurokinin 1 Receptor (NK1R)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS

• Gene ID:
• 6869

• Uniprot-ID:
• P25103

• Purification Method:
• HeLa, SH-SY5Y, Mouse brain, Rat brain, Rat spleen

• Positive Samples:
• Affinity purification