Rabbit anti-Human NEDD4L Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16731P

• Product Name:
• Rabbit anti-Human NEDD4L Monoclonal Antibody

• Synonym:
• RSP5; PVNH7; NEDD4-2; NEDD4.2; hNEDD4-2; NEDD4L

• Description:
• The antibody against NEDD4L was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 876-975 of human NEDD4L (Q96PU5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 876-975 of human NEDD4L (Q96PU5).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NEDD4L

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD

• Gene ID:
• 23327

• Uniprot-ID:
• Q96PU5

• Purification Method:
• HeLa, K-562

• Positive Samples:
• Affinity purification