Rabbit anti-Human NDUFC2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14559P

• Product Name:
• Rabbit anti-Human NDUFC2 Monoclonal Antibody

• Synonym:
• HLC-1; B14.5b; MC1DN36; NADHDH2; CI-B14.5b; NDUFC2

• Description:
• The antibody against NDUFC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human NDUFC2 (NP_004540.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-119 of human NDUFC2 (NP_004540.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NDUFC2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR

• Gene ID:
• 4718

• Uniprot-ID:
• O95298

• Purification Method:
• HepG2, A-549

• Positive Samples:
• Affinity purification