Rabbit anti-Human NCR3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15478P

• Product Name:
• Rabbit anti-Human NCR3 Monoclonal Antibody

• Synonym:
• NCR3; 1C7; CD337; LY117; MALS; NKp30; natural cytotoxicity triggering receptor 3

• Description:
• The antibody against NCR3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• NCR3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG

• Gene ID:
• 259197

• Uniprot-ID:
• O14931

• Purification Method:
• 293T transfected with NCR3 (Human)

• Positive Samples:
• Affinity purification