Rabbit anti-Human Musashi-1 (MSI1) Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14183P

• Product Name:
• Rabbit anti-Human Musashi-1 (MSI1) Monoclonal Antibody

• Synonym:
• MSI1; musashi RNA binding protein 1; Musashi-1 (MSI1)

• Description:
• The antibody against Musashi-1 (MSI1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSI1 (O43347) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSI1 (O43347).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Musashi-1 (MSI1)

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRA

• Gene ID:
• 4440

• Uniprot-ID:
• O43347

• Purification Method:
• SH-SY5Y, Mouse brain

• Positive Samples:
• Affinity purification