Rabbit anti-Human MTHFD2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15004P

• Product Name:
• Rabbit anti-Human MTHFD2 Monoclonal Antibody

• Synonym:
• NMDMC; MTHFD2

• Description:
• The antibody against MTHFD2 was raised in Rabbit using the recombinant funsion protein containing a sequence corresponding to amino acids 40-250 of human MTHFD2 (NP_006627.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant funsion protein containing a sequence corresponding to amino acids 40-250 of human MTHFD2 (NP_006627.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• MTHFD2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• ISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTILADIV

• Gene ID:
• 10797

• Uniprot-ID:
• P13995

• Purification Method:
• HT-29, HeLa, 293F, Mouse testis

• Positive Samples:
• Affinity purification