Rabbit anti-Human MS4A14 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13303P

• Product Name:
• Rabbit anti-Human MS4A14 Monoclonal Antibody

• Synonym:
• MS4A16; NYD-SP21; MS4A14

• Description:
• The antibody against MS4A14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 150-280 of human MS4A14 (Q96JA4).

• Species Reactivity:
• Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• MS4A14

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FSRTLFIVLFFLPSDVTQNSEQPAPEENDQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPPTLEKKPSENMSIQLDSTFKQMKDEDLQ

• Gene ID:
• 84689

• Uniprot-ID:
• Q96JA4

• Purification Method:
• Rat testis

• Positive Samples:
• Affinity purification