Rabbit anti-Human MDH2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13182P

• Product Name:
• Rabbit anti-Human MDH2 Monoclonal Antibody

• Synonym:
• MDH; MOR1; DEE51; M-MDH; EIEE51; MGC:3559; MDH2

• Description:
• The antibody against MDH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MDH2 (P40926).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• MDH2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPI

• Gene ID:
• 4191

• Uniprot-ID:
• P40926

• Purification Method:
• HeLa, A-431, NIH/3T3, U-87MG, Mouse small intestine, Rat kidney

• Positive Samples:
• Affinity purification