Rabbit anti-Human MARK2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14168P

• Product Name:
• Rabbit anti-Human MARK2 Monoclonal Antibody

• Synonym:
• EMK1; EMK-1; PAR-1; Par1b; Par-1b; MARK2

• Description:
• The antibody against MARK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 689-788 of human MARK2 (Q7KZI7).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• MARK2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYMLLCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIANELKL

• Gene ID:
• 2011

• Uniprot-ID:
• Q7KZI7

• Purification Method:
• BT-474, Raji, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification