Rabbit anti-Human Mammaglobin A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14261P

• Product Name:
• Rabbit anti-Human Mammaglobin A Monoclonal Antibody

• Synonym:
• MGB1; UGB2; PSBP1; Mammaglobin A

• Description:
• The antibody against Mammaglobin A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human Mammaglobin A (Q13296) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of human Mammaglobin A (Q13296).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Mammaglobin A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

• Gene ID:
• 4250

• Uniprot-ID:
• Q13296

• Purification Method:
• BT-474 cells

• Positive Samples:
• Affinity purification